PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A08G1106
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 275aa    MW: 31155.3 Da    PI: 9.042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A08G1106genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.8e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed llv++++ +  g+W++ + + g+ R++k+c++rw +yl
      Gh_A08G1106 14 KGPWTSREDTLLVNYIQAHDEGHWRSLPMKAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.83.9e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ +++Ed+l+++++ +lG++ W++Ia +++ gRt++++k++w++ 
      Gh_A08G1106  67 RGNISPDEDDLIIRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTN 111
                      7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.278961IPR017930Myb domain
SuperFamilySSF466891.34E-2811108IPR009057Homeodomain-like
SMARTSM007172.4E-101363IPR001005SANT/Myb domain
PfamPF002491.5E-111461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-211568IPR009057Homeodomain-like
CDDcd001675.68E-81661No hitNo description
PROSITE profilePS5129425.43762116IPR017930Myb domain
SMARTSM007171.0E-1566114IPR001005SANT/Myb domain
PfamPF002499.7E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2569116IPR009057Homeodomain-like
CDDcd001671.32E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGRSPCCSKV GLHKGPWTSR EDTLLVNYIQ AHDEGHWRSL PMKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI SPDEDDLIIR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT NLSKRLLSQG  120
IDPNTHKTLP KPVVQQVKKK NNNRGSNNKQ NPKKANATHE PAVIPKLHLP KPSRITTVFL  180
PRNDSFDQCT RFSTVSSSQR GEGALDTEAI KCPWSEYVND GEKGTGLLSD LECHSGLPAT  240
GDKNSLEKLY EEYLQLLRTD EDQLQLDDFA ESFLI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25121165108B-MYB
1h8a_C1e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475067.10.0PREDICTED: myb-related protein 308-like
SwissprotQ9S9K92e-69MYB3_ARATH; Transcription factor MYB3
TrEMBLA0A0D2PCA70.0A0A0D2PCA7_G
STRINGPOPTR_0014s09630.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.14e-69myb domain protein 3